Emails an Freenet-Nutzer werden abgelehnt (2023)

\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t

\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t<\/p>\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t<\/div>\n\n\t\t\t\n\t\t<\/div>","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};LITHIUM.Dialog({ "closeImageIconURL" : "https://forum.vodafone.de/skins/images/6DA174B1B19F1108905652A379464B48/responsive_peak/images/button_dialog_close.svg", "closeEvent" : "LITHIUM:lightboxCloseEvent", "activecastFullscreen" : false, "defaultAriaLabel" : "", "accessibility" : false, "buttonDialogCloseAlt" : "Schließen", "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "dialogContentCssClass" : "lia-panel-dialog-content", "triggerEvent" : "LITHIUM:triggerDialogEvent", "dialogKey" : "dialogKey"});LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."});LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating');LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2601163 .lia-rating-control-passive', '#form');LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '8v1x7UBgGV8oiL16Y90DV4pePvThgJP17Hm-kU7vYgQ.', 'ajax');LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "kudoEntity", "actions" : [ { "context" : "envParam:entity", "action" : "rerender" } ] } ], "componentId" : "kudos.widget.button", "initiatorBinding" : true, "selector" : "#kudosButtonV2", "parameters" : { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "revokeMode" : "true", "kudosable" : "true", "showCountOnly" : "false", "disableKudosForAnonUser" : "false", "useCountToKudo" : "false", "entity" : "2601163", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id"});;(function($) { $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/});})(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "approveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "unapproveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "deleteMessage", "actions" : [ { "context" : "lia-deleted-state", "action" : "addClassName" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "QuickReply", "actions" : [ { "context" : "envParam:feedbackData", "action" : "rerender" } ] }, { "event" : "expandMessage", "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswer", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswerComment", "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" } ] }, { "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName,message", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "ProductMessageEdit", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "MessagesWidgetMessageEdit", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "RevokeSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "MessagesWidgetAnswerForm", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] } ], "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "selector" : "#messageview", "parameters" : { "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "truncateBody" : "true", "message" : "2601163", "includeRepliesModerationState" : "false", "useSimpleView" : "false", "useTruncatedSubject" : "true", "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101011101", "displaySubject" : "true" }, "initiatorDataMatcher" : "data-lia-message-uid"});LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2601163,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Bist du sicher, dass du fortfahren möchtest?","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"9q9aLx-dXM7snkpj9GfbfeqEnmxfnn6qEaNJWkDZ3VU."});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); (function () { "use strict"; // Your code here... (function($) { console.log("I AM FORUM MESSAGE") console.log(LITHIUM) })(LITHIUM.jQuery);})();LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}});LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"});LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating');LITHIUM.Dialog.options['-318204281'] = {"contentContext":" <\/span>\n\n\t\n\t\t

\n\t\t\t

\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t

\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t<\/p>\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t<\/div>\n\n\t\t\t\n\t\t<\/div>","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating');LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2601176 .lia-rating-control-passive', '#form_0');LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'iyGBa45ZSKu7wV5mYVSH5sF8C3oGJ29iGPwttImgg1w.', 'ajax');LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "kudoEntity", "actions" : [ { "context" : "envParam:entity", "action" : "rerender" } ] } ], "componentId" : "kudos.widget.button", "initiatorBinding" : true, "selector" : "#kudosButtonV2_0", "parameters" : { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "revokeMode" : "true", "kudosable" : "true", "showCountOnly" : "false", "disableKudosForAnonUser" : "false", "useCountToKudo" : "false", "entity" : "2601176", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id"});;(function($) { $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/});})(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "approveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "unapproveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "deleteMessage", "actions" : [ { "context" : "lia-deleted-state", "action" : "addClassName" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "QuickReply", "actions" : [ { "context" : "envParam:feedbackData", "action" : "rerender" } ] }, { "event" : "expandMessage", "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswer", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswerComment", "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" } ] }, { "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName,message", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "ProductMessageEdit", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "MessagesWidgetMessageEdit", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "RevokeSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "MessagesWidgetAnswerForm", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] } ], "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "selector" : "#messageview_0", "parameters" : { "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "truncateBody" : "true", "message" : "2601176", "includeRepliesModerationState" : "false", "useSimpleView" : "false", "useTruncatedSubject" : "true", "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101", "displaySubject" : "true" }, "initiatorDataMatcher" : "data-lia-message-uid"});LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2601176,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Bist du sicher, dass du fortfahren möchtest?","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cijYqVrS1lVU3tkk5ci1PlqOuIne46wXGPNMLolGHqs."});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); (function () { "use strict"; // Your code here... (function($) { console.log("I AM FORUM MESSAGE") console.log(LITHIUM) })(LITHIUM.jQuery);})();LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}});LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"});LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating');LITHIUM.Dialog.options['1559689741'] = {"contentContext":" <\/span>\n\n\t\n\t\t

\n\t\t\t

(Video) iPhone Email FEHLER? So behebst du Sie!

\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t

\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t<\/p>\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t<\/div>\n\n\t\t\t\n\t\t<\/div>","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating');LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2601183 .lia-rating-control-passive', '#form_1');LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'XgIJs7p-gKOwnKPVzpa_DnFDoREjKzUPdVAeqRmjyuc.', 'ajax');LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "kudoEntity", "actions" : [ { "context" : "envParam:entity", "action" : "rerender" } ] } ], "componentId" : "kudos.widget.button", "initiatorBinding" : true, "selector" : "#kudosButtonV2_1", "parameters" : { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "revokeMode" : "true", "kudosable" : "true", "showCountOnly" : "false", "disableKudosForAnonUser" : "false", "useCountToKudo" : "false", "entity" : "2601183", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id"});;(function($) { $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/});})(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "approveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "unapproveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "deleteMessage", "actions" : [ { "context" : "lia-deleted-state", "action" : "addClassName" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "QuickReply", "actions" : [ { "context" : "envParam:feedbackData", "action" : "rerender" } ] }, { "event" : "expandMessage", "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswer", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswerComment", "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" } ] }, { "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName,message", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "ProductMessageEdit", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "MessagesWidgetMessageEdit", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "RevokeSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "MessagesWidgetAnswerForm", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] } ], "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "selector" : "#messageview_1", "parameters" : { "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "truncateBody" : "true", "message" : "2601183", "includeRepliesModerationState" : "false", "useSimpleView" : "false", "useTruncatedSubject" : "true", "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101", "displaySubject" : "true" }, "initiatorDataMatcher" : "data-lia-message-uid"});LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2601183,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Bist du sicher, dass du fortfahren möchtest?","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"2P93Q53Smq3GmAxgdP3suLXuLWsc930Qp7N-SxkSDWo."});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); (function () { "use strict"; // Your code here... (function($) { console.log("I AM FORUM MESSAGE") console.log(LITHIUM) })(LITHIUM.jQuery);})();LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}});LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"});LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating');LITHIUM.Dialog.options['-1122051711'] = {"contentContext":" <\/span>\n\n\t\n\t\t

\n\t\t\t

\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t

\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t<\/p>\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t<\/div>\n\n\t\t\t\n\t\t<\/div>","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating');LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2601188 .lia-rating-control-passive', '#form_2');LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'm4WztNVw1ksycS9n5fAVDg3ja1Kl8rN5d5dsaXIwaNo.', 'ajax');LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "kudoEntity", "actions" : [ { "context" : "envParam:entity", "action" : "rerender" } ] } ], "componentId" : "kudos.widget.button", "initiatorBinding" : true, "selector" : "#kudosButtonV2_2", "parameters" : { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "revokeMode" : "true", "kudosable" : "true", "showCountOnly" : "false", "disableKudosForAnonUser" : "false", "useCountToKudo" : "false", "entity" : "2601188", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id"});;(function($) { $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/});})(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "approveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "unapproveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "deleteMessage", "actions" : [ { "context" : "lia-deleted-state", "action" : "addClassName" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "QuickReply", "actions" : [ { "context" : "envParam:feedbackData", "action" : "rerender" } ] }, { "event" : "expandMessage", "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswer", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswerComment", "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" } ] }, { "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName,message", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "ProductMessageEdit", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "MessagesWidgetMessageEdit", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "RevokeSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "MessagesWidgetAnswerForm", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] } ], "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "selector" : "#messageview_2", "parameters" : { "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "truncateBody" : "true", "message" : "2601188", "includeRepliesModerationState" : "false", "useSimpleView" : "false", "useTruncatedSubject" : "true", "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101", "displaySubject" : "true" }, "initiatorDataMatcher" : "data-lia-message-uid"});LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2601188,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Bist du sicher, dass du fortfahren möchtest?","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"QWdoZz1dPVcR2fGtDKSS_MW09rkSAtagXINQJlMxeDc."});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); (function () { "use strict"; // Your code here... (function($) { console.log("I AM FORUM MESSAGE") console.log(LITHIUM) })(LITHIUM.jQuery);})();LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}});LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"});LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating');LITHIUM.Dialog.options['-1807417893'] = {"contentContext":" <\/span>\n\n\t\n\t\t

\n\t\t\t

\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t

\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t<\/p>\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t<\/div>\n\n\t\t\t\n\t\t<\/div>","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating');LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2601197 .lia-rating-control-passive', '#form_3');LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'DxvOjt3lgGDUcXQmHN6R9-zlezYgWiyFGHH7_5UOwqc.', 'ajax');LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "kudoEntity", "actions" : [ { "context" : "envParam:entity", "action" : "rerender" } ] } ], "componentId" : "kudos.widget.button", "initiatorBinding" : true, "selector" : "#kudosButtonV2_3", "parameters" : { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "revokeMode" : "true", "kudosable" : "true", "showCountOnly" : "false", "disableKudosForAnonUser" : "false", "useCountToKudo" : "false", "entity" : "2601197", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id"});;(function($) { $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/});})(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "approveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "unapproveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "deleteMessage", "actions" : [ { "context" : "lia-deleted-state", "action" : "addClassName" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "QuickReply", "actions" : [ { "context" : "envParam:feedbackData", "action" : "rerender" } ] }, { "event" : "expandMessage", "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswer", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswerComment", "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" } ] }, { "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName,message", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "ProductMessageEdit", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "MessagesWidgetMessageEdit", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "RevokeSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "MessagesWidgetAnswerForm", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] } ], "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "selector" : "#messageview_3", "parameters" : { "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "truncateBody" : "true", "message" : "2601197", "includeRepliesModerationState" : "false", "useSimpleView" : "false", "useTruncatedSubject" : "true", "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101", "displaySubject" : "true" }, "initiatorDataMatcher" : "data-lia-message-uid"});LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2601197,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Bist du sicher, dass du fortfahren möchtest?","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cuw2AuILO90PAFNSbGZplhlc5crCWIbyYn1Mvr4FKu4."});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); (function () { "use strict"; // Your code here... (function($) { console.log("I AM FORUM MESSAGE") console.log(LITHIUM) })(LITHIUM.jQuery);})();LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}});LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"});LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating');LITHIUM.Dialog.options['-2044868429'] = {"contentContext":" <\/span>\n\n\t\n\t\t

\n\t\t\t

\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t

\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t<\/p>\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t<\/div>\n\n\t\t\t\n\t\t<\/div>","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating');LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2601474 .lia-rating-control-passive', '#form_4');LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'qetebyn4-xmvCtjx8sjDZKo3CFGbX0lp4E6Cb4Ajer8.', 'ajax');LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "kudoEntity", "actions" : [ { "context" : "envParam:entity", "action" : "rerender" } ] } ], "componentId" : "kudos.widget.button", "initiatorBinding" : true, "selector" : "#kudosButtonV2_4", "parameters" : { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "revokeMode" : "true", "kudosable" : "true", "showCountOnly" : "false", "disableKudosForAnonUser" : "false", "useCountToKudo" : "false", "entity" : "2601474", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id"});;(function($) { $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/});})(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "approveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "unapproveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "deleteMessage", "actions" : [ { "context" : "lia-deleted-state", "action" : "addClassName" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "QuickReply", "actions" : [ { "context" : "envParam:feedbackData", "action" : "rerender" } ] }, { "event" : "expandMessage", "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswer", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswerComment", "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" } ] }, { "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName,message", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "ProductMessageEdit", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "MessagesWidgetMessageEdit", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "RevokeSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "MessagesWidgetAnswerForm", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] } ], "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "selector" : "#messageview_4", "parameters" : { "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "truncateBody" : "true", "message" : "2601474", "includeRepliesModerationState" : "false", "useSimpleView" : "false", "useTruncatedSubject" : "true", "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101", "displaySubject" : "true" }, "initiatorDataMatcher" : "data-lia-message-uid"});LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2601474,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Bist du sicher, dass du fortfahren möchtest?","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mpgrkKb67zKjnJ5qDFQ1gJGTdCH098yL5_ak4hEqmis."});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); (function () { "use strict"; // Your code here... (function($) { console.log("I AM FORUM MESSAGE") console.log(LITHIUM) })(LITHIUM.jQuery);})();LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}});LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"});LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating');LITHIUM.Dialog.options['-283533303'] = {"contentContext":" <\/span>\n\n\t\n\t\t

\n\t\t\t

\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t

\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t<\/p>\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t<\/div>\n\n\t\t\t\n\t\t<\/div>","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating');LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2602063 .lia-rating-control-passive', '#form_5');LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '8K3hqXa0KiH-WxZxM3iDOkni9nG7y4fSY3GzkkIZzho.', 'ajax');LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "kudoEntity", "actions" : [ { "context" : "envParam:entity", "action" : "rerender" } ] } ], "componentId" : "kudos.widget.button", "initiatorBinding" : true, "selector" : "#kudosButtonV2_5", "parameters" : { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "revokeMode" : "true", "kudosable" : "true", "showCountOnly" : "false", "disableKudosForAnonUser" : "false", "useCountToKudo" : "false", "entity" : "2602063", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id"});;(function($) { $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/});})(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "approveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "unapproveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "deleteMessage", "actions" : [ { "context" : "lia-deleted-state", "action" : "addClassName" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "QuickReply", "actions" : [ { "context" : "envParam:feedbackData", "action" : "rerender" } ] }, { "event" : "expandMessage", "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswer", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswerComment", "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" } ] }, { "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName,message", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "ProductMessageEdit", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "MessagesWidgetMessageEdit", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "RevokeSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "MessagesWidgetAnswerForm", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] } ], "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "selector" : "#messageview_5", "parameters" : { "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "truncateBody" : "true", "message" : "2602063", "includeRepliesModerationState" : "false", "useSimpleView" : "false", "useTruncatedSubject" : "true", "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101", "displaySubject" : "true" }, "initiatorDataMatcher" : "data-lia-message-uid"});LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2602063,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Bist du sicher, dass du fortfahren möchtest?","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iBxKujWXaD2VPf42gp-bizD_3mLVBhdZIYlU-GzKtDo."});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); (function () { "use strict"; // Your code here... (function($) { console.log("I AM FORUM MESSAGE") console.log(LITHIUM) })(LITHIUM.jQuery);})();LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}});LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"});LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating');LITHIUM.Dialog.options['597493939'] = {"contentContext":" <\/span>\n\n\t\n\t\t

\n\t\t\t

\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t

(Video) Can't Send Emails from iPhone / iPad - Solution

\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t<\/p>\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t<\/div>\n\n\t\t\t\n\t\t<\/div>","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating');LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2604599 .lia-rating-control-passive', '#form_6');LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'vYJXfuc8C-DlQR27RIRFwwPDPb0zAq_3TJM3gMcUsBM.', 'ajax');LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "kudoEntity", "actions" : [ { "context" : "envParam:entity", "action" : "rerender" } ] } ], "componentId" : "kudos.widget.button", "initiatorBinding" : true, "selector" : "#kudosButtonV2_6", "parameters" : { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "revokeMode" : "true", "kudosable" : "true", "showCountOnly" : "false", "disableKudosForAnonUser" : "false", "useCountToKudo" : "false", "entity" : "2604599", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id"});;(function($) { $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/});})(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "approveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "unapproveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "deleteMessage", "actions" : [ { "context" : "lia-deleted-state", "action" : "addClassName" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "QuickReply", "actions" : [ { "context" : "envParam:feedbackData", "action" : "rerender" } ] }, { "event" : "expandMessage", "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswer", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswerComment", "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" } ] }, { "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName,message", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "ProductMessageEdit", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "MessagesWidgetMessageEdit", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "RevokeSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "MessagesWidgetAnswerForm", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] } ], "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "selector" : "#messageview_6", "parameters" : { "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "truncateBody" : "true", "message" : "2604599", "includeRepliesModerationState" : "false", "useSimpleView" : "false", "useTruncatedSubject" : "true", "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101", "displaySubject" : "true" }, "initiatorDataMatcher" : "data-lia-message-uid"});LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2604599,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Bist du sicher, dass du fortfahren möchtest?","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pAQGay7qhebVAFt3tM0gT6ojoZC-yCRF7OZl0PWTIhI."});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); (function () { "use strict"; // Your code here... (function($) { console.log("I AM FORUM MESSAGE") console.log(LITHIUM) })(LITHIUM.jQuery);})();LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}});LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"});LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating');LITHIUM.Dialog.options['-670948873'] = {"contentContext":" <\/span>\n\n\t\n\t\t

\n\t\t\t

\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t

\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t<\/p>\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t<\/div>\n\n\t\t\t\n\t\t<\/div>","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating');LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2605182 .lia-rating-control-passive', '#form_7');LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'd_SEf-1K9Q7ZnhrxWz-Iz3sfRM9E3ue7lVOp2aY3_c0.', 'ajax');LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "kudoEntity", "actions" : [ { "context" : "envParam:entity", "action" : "rerender" } ] } ], "componentId" : "kudos.widget.button", "initiatorBinding" : true, "selector" : "#kudosButtonV2_7", "parameters" : { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "revokeMode" : "true", "kudosable" : "true", "showCountOnly" : "false", "disableKudosForAnonUser" : "false", "useCountToKudo" : "false", "entity" : "2605182", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id"});;(function($) { $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/});})(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "approveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "unapproveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "deleteMessage", "actions" : [ { "context" : "lia-deleted-state", "action" : "addClassName" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "QuickReply", "actions" : [ { "context" : "envParam:feedbackData", "action" : "rerender" } ] }, { "event" : "expandMessage", "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswer", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswerComment", "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" } ] }, { "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName,message", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "ProductMessageEdit", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "MessagesWidgetMessageEdit", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "RevokeSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "MessagesWidgetAnswerForm", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] } ], "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "selector" : "#messageview_7", "parameters" : { "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "truncateBody" : "true", "message" : "2605182", "includeRepliesModerationState" : "false", "useSimpleView" : "false", "useTruncatedSubject" : "true", "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101", "displaySubject" : "true" }, "initiatorDataMatcher" : "data-lia-message-uid"});LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2605182,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Bist du sicher, dass du fortfahren möchtest?","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wLG-hhxQ1mjsLXlp8iYzxqFWv_8cvF07QRgedoJTCGA."});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); (function () { "use strict"; // Your code here... (function($) { console.log("I AM FORUM MESSAGE") console.log(LITHIUM) })(LITHIUM.jQuery);})();LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}});LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"});LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"});LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating');LITHIUM.Dialog.options['-365400057'] = {"contentContext":" <\/span>\n\n\t\n\t\t

\n\t\t\t

\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t

\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t<\/p>\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t<\/div>\n\n\t\t\t\n\t\t<\/div>","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating');LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2606276 .lia-rating-control-passive', '#form_8');LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'NwZEi0qw1aQ9yHKro4FVzZlt776gUMTjSlsVIyDUjak.', 'ajax');LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "kudoEntity", "actions" : [ { "context" : "envParam:entity", "action" : "rerender" } ] } ], "componentId" : "kudos.widget.button", "initiatorBinding" : true, "selector" : "#kudosButtonV2_8", "parameters" : { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "revokeMode" : "true", "kudosable" : "true", "showCountOnly" : "false", "disableKudosForAnonUser" : "false", "useCountToKudo" : "false", "entity" : "2606276", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id"});;(function($) { $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/});})(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ { "event" : "approveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "unapproveMessage", "actions" : [ { "context" : "", "action" : "rerender" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "deleteMessage", "actions" : [ { "context" : "lia-deleted-state", "action" : "addClassName" }, { "context" : "", "action" : "pulsate" } ] }, { "event" : "QuickReply", "actions" : [ { "context" : "envParam:feedbackData", "action" : "rerender" } ] }, { "event" : "expandMessage", "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswer", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "ProductAnswerComment", "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" } ] }, { "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName,message", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "ProductMessageEdit", "actions" : [ { "context" : "envParam:quiltName", "action" : "rerender" } ] }, { "event" : "MessagesWidgetMessageEdit", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "RevokeSolutionAction", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "addMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "removeMessageUserEmailSubscription", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "context" : "", "action" : "rerender" } ] }, { "event" : "MessagesWidgetAnswerForm", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] } ], "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "selector" : "#messageview_8", "parameters" : { "disableLabelLinks" : "false", "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "useSubjectIcons" : "true", "quiltName" : "ForumMessage", "truncateBody" : "true", "message" : "2606276", "includeRepliesModerationState" : "false", "useSimpleView" : "false", "useTruncatedSubject" : "true", "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101", "displaySubject" : "true" }, "initiatorDataMatcher" : "data-lia-message-uid"});LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2606276,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Bist du sicher, dass du fortfahren möchtest?","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"YBOKChg8xX6r1n3jbmJVuhspAvSga3ZM3zvc2kWOUeg."});LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"});;(function($) { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ $(this).toggleClass("view-btn-open view-btn-close"); $(this).next().toggle(); });})(LITHIUM.jQuery); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HUiUheAVEvIyVR8rFcdKmnOgFU72g37rPhcHwCqxiuI."});LITHIUM.Dialog.options['482247279'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"};LITHIUM.Dialog({ "closeImageIconURL" : "https://forum.vodafone.de/skins/images/6DA174B1B19F1108905652A379464B48/responsive_peak/images/button_dialog_close.svg", "closeEvent" : "LITHIUM:lightboxCloseEvent", "activecastFullscreen" : false, "defaultAriaLabel" : "", "accessibility" : false, "buttonDialogCloseAlt" : "Schließen", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "dialogContentCssClass" : "lia-panel-dialog-content", "triggerEvent" : "click", "dialogKey" : "dialogKey"});LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":183236});LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"});LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/58534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iu4APSGn2dCrA47fWQPQOgXFv1oVSLj3XbK6NjewjVE."});LITHIUM.Auth.API_URL = '/t5/util/authcheckpage';LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/meinvodafone/account/login?targetURL=https:%2F%2Fforum.vodafone.de&target=https%3A%2F%2FREPLACE_TEXT';LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive';LITHIUM.Auth.KEEP_ALIVE_TIME = 300000;LITHIUM.Auth.CHECK_SESSION_TOKEN = 'uON-umosuQ8gNwnHiMCype06Z__DTk3ImyzFFqu6RPU.';LITHIUM.AjaxSupport.useTickets = false;LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601163}},{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601176}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601183}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601188}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601197}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601474}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602063}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2604599}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2605182}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2606276}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2638753}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1845177}}]);LITHIUM.Loader.runJsAttached();// -->

(Video) How to Get Your Email to the Inbox I Mailchimp

(Video) How to process a mail Order or telephone order MOTO transaction

(Video) Nur noch sichere E-Mails im Postfach - so geht's (Webinar 17.08.22) | JAM Software

FAQs

Warum kann ich bei Freenet keine Mails verschicken? ›

Probieren Sie daher einen anderen Browser. Eventuell sind die Server Ihres Providers derzeit ausgefallen und somit nicht erreichbar. Eine weitere mögliche Ursache ist, dass die Server von Freenet vorübergehend überlastet sind und somit nicht zur Verfügung stehen. Versuchen Sie es zu einem späteren Zeitpunkt erneut.

Warum kommt die E-Mail nicht an? ›

Der Empfänger hat Ihre E-Mail nicht erhalten

Überprüfen Sie die Ordner "Gesendet" und "Entwürfe". Falls sich die E-Mail nicht in einem dieser Ordner befindet, haben Sie sie vielleicht vor dem Senden gelöscht. Bitten Sie den Empfänger, sicherzustellen, dass Ihre E-Mail nicht versehentlich als Spam herausgefiltert wurde.

Kann man E-Mail Adressen blockieren Freenet? ›

Sie können einzelne E-Mail-Absender auf eine sogenannte "Allowlist" oder "Blocklist" setzen. Über die "Allowlist" werden Empfänger grundsätzlich für Ihr Postfach freigegeben. E-Mails von Absendern auf der "Blocklist" werden automatisch in den Ordner "Spamverdacht" verschoben.

Was tun wenn ich keine Mails verschicken kann? ›

Probleme beim E-Mail-Versand
  1. Falsche Konfiguration. Überprüfen Sie zuerst in den Einstellungen Ihres E-Mail-Programms, ob dort die korrekten Zugangsdaten hinterlegt sind. ...
  2. Gesperrter Port. Diverse Internet-Provider sperren ihr Netzwerk für ausgehenden SMTP-Verkehr (Port 25). ...
  3. 3. Mail Delivery Notification.

Ist Freenet IMAP oder POP? ›

Um den Leistungsumfang von freenet Mail voll auszuschöpfen nutzen Sie bitte den Zugriff per IMAP. Zukünftig wird der Zugriff über POP3 nicht mehr unterstützt.

Wo landen Mails die nicht ankommen? ›

Am wahrscheinlichsten wird wohl sein, dass Deine Mails im Spam-Ordner gelandet sind, und Dein Gegenüber diesen Ordner nicht regelmäßig kontrolliert. Die Defaulteinstellungen sind meist so, dass Mails die dort landen, dort nur relativ kurze Zeit vorgehalten und dann automatisch gelöscht werden.

Was passiert wenn der Server des Empfängers einer E-Mail nicht erreichbar ist? ›

Wenn ein Zielserver nach 4 Tagen nicht mehr erreicht werden kann, werden alle Nachrichten nach 4 Tagen abgewiesen (gebounced) und weitere E-Mails nicht mehr akzeptiert/in der Warteschlange gespeichert, bis dieser wieder erreichbar ist. Diese 4 tägige Frist ist konform mit den Richtlinien nach SMTP RFC.

Kann ich sehen ob jemand meine E-Mail-Adresse blockiert hat? ›

Das können Sie tun
  1. Überprüfen Sie die Empfängeradresse auf folgende häufige Fehler: Anführungszeichen. Punkte am Ende der Adresse. Leerzeichen vor oder nach der Adresse. Rechtschreibfehler.
  2. Sehen Sie in Ihren Kontakten nach, ob der Empfänger noch eine andere E-Mail-Adresse verwendet.

Kann man Mails von bestimmten Personen blockieren? ›

Blockieren eines Absenders

Wenn Sie Nachrichten einer Person nicht mehr anzeigen möchten, können Sie den jeweiligen Absender sperren. Klicken Sie mit der rechten Maustaste auf eine Nachricht des Absenders, den Sie sperren möchten, und klicken Sie dann auf Junk-E-Mail > Absender sperren.

Kann man bestimmte E-Mail Adressen blockieren? ›

E-Mail-Adresse blockieren

Öffnen Sie auf dem Android-Smartphone oder -Tablet die Gmail App . Öffnen Sie die Nachricht. Tippen Sie auf [Absender] blockieren.

Wieso werden manche Mails nicht verschickt? ›

Wenn Mails über Outlook, Thunderbird oder ein anderes Mail-Programm nicht versendet werden können, dann kann das vielerlei Gründe haben: Serverdaten oder Zugangspasswort können falsch sein, der Netzwerkverkehr kann blockiert sein, der Mail-Client ist eventuell deaktiviert, und und und.

Warum geht Mail nicht aus Postausgang? ›

Eine mögliche Ursache kann der Mailserver sein. Wenn dieser nicht online ist, dann kann ihre Outlook E-Mail nicht gesendet werden. Anhand der Anzeige im unteren Balken lässt sich dies überprüfen. Sollte ihr Mailserver nicht verbunden sein, dann wird hier „Getrennt“ oder „Verbindungsversuch…“ angezeigt.

Was bedeutet die Absenderadresse war ungültig? ›

die Fehlermeldung "Unauthorized sender address" erhalten, nutzen Sie eine zu Ihrem WEB.DE Postfach abweichende E-Mail-Adresse als Absendeadresse. Da es sich hierbei um ein bekanntes Spam-Kriterium handelt, ist es möglich, dass E-Mails mit solchen Absendeadressen von Ihrem Zielpostfach abgelehnt werden.

Warum geht Freenet nicht? ›

In den häufigsten Fällen liegt der Fehler im Zusammenspiel des Browsers mit freenet Mail begründet. Zunächst sollten daher die temporären Dateien im Speicher, sprich Cookies und Cache gelöscht. In vielen Fällen klappt danach das Laden schon wieder.

Wie aktiviere ich IMAP bei Freenet? ›

Wenn Sie mit Ihrem freenet Mail Postfach auf ein E-Mail-Programm zugreifen möchten, muss in den Postfach-Einstellungen die Übergangsprotokolle unter dem Punkt "Einrichtung POP3/IMAP" im Bereich „POP3/IMAP/SMTP“ aktiviert sein.

Was ist besser POP3 oder IMAP? ›

IMAP: Der Speicherplatz des E-Mail-Postfaches ist schneller voll, wenn Sie keine E-Mails löschen und Sie benötigen immer eine Internetverbindung, wenn Sie Ihre E-Mails lesen wollen. POP3: Das Abrufen von E-Mails auf mehreren Geräten ist nicht möglich und E-Mail-Backups sind kaum möglich.

Was bedeutet der Empfänger wurde vom Server abgelehnt? ›

Diese Fehlermeldung wird angezeigt, wenn keine Verbindung zwischen Gmail und dem E-Mail-Server des Empfängers hergestellt werden kann.

Was bedeutet Undelivered Mail Return to Sender? ›

Die Fehlermeldung „Undelivered Mail returned to senderbedeutet, dass eine verschickte E-Mail dem Empfänger nicht zugestellt werden konnte.

Was ist ein SMTP Fehler? ›

SMTP ist ein Internetstandard, der von Mailservern zum Senden und Empfangen von E-Mails verwendet wird. Anhand von SMTP-Fehlermeldungen können Sie nachvollziehen, warum eine Nachricht nicht gesendet wurde.

Wie sehe ich ob ich blockiert bin? ›

Der doppelte Haken

Wenn man einer Person eine Nachricht schickt und neben dem Chatfenster nur ein kleiner Haken anstatt zwei erscheinen, dann kann das ein Hinweis darauf sein, dass man geblockt wurde. Falls die Person die Nachricht aber doch liest, wird einem selbst der zweite Haken nicht angezeigt.

Warum bekomme ich immer noch Mails von blockierten Absendern? ›

Oft erhalten wir immer noch Nachrichten von blockierten Absendern. Dies kann vorkommen, wenn eine E-Mail-Adresse so gefälscht wurde, dass ein anderer Name im Feld "From:" angezeigt wird. Der echte Name der blockierten E-Mail-Adresse kann identifiziert und dauerhaft gestoppt werden.

Warum blockieren Frauen? ›

Sie wollen jemanden, der mit ihnen auf Augenhöhe steht und auch mal ,Nein´ sagen kann. Gerade wenn du es mit einer selbstbewussten und temperamentvollen Frau zu tun hast, findet sie es schlichtweg einfach unattraktiv, wenn du zu nett zu ihr bist. Gehe mal in dich und überlege, ob du vielleicht zu nett gewesen bist.

Wann sollte man jemanden blockieren? ›

Typische Gründe, jemanden zu blockieren. Ganz allgemein gibt es natürlich einige Gründe, ohne weitere Diskussionen die Kontaktmöglichkeit zu beschränken. Meistens sind es diese hier: ungutes Gefühl/Verdacht auf Scamming.

Warum bekomme ich auf einmal so viele Spam Mails? ›

Spam-Adressen bestehen meist aus zufällig oder systematisch generierten Adressen. Meist kommen diese Spammer oder Spambots über den sog. Adresshandel an die E-Mail Adressen der Empfänger, d.h. diese kaufen oder mieten Datensätze, welche verschiedene E-Mail Adressen enthalten.

Warum Spam nicht löschen? ›

Beim Sichten und Löschen öffnet man aus Versehen eine der Mails und der Spammer bekommt die Bestätigung, dass es diese Adresse tatsächlich gibt. Noch mehr Spam-Mails im Postfach sind die logische Folge. Direkt gefährlich wird es, wenn die Spam-Mail Links und Inhalte transportiert, die mit Schadsoftware verseucht sind.

Wen de Absender blockieren? ›

So tragen Sie eine Adresse/Domain in Ihre Sperrliste ein

Klicken Sie auf Einstellungen. Wählen Sie Sperrliste aus. Tragen Sie die gewünschte E-Mail-Adresse/Domain ein. Klicken Sie auf Speichern.

Kann Nachricht nicht versenden Fehler beim Verbinden mit dem SMTP Server? ›

Es gibt ein Port-Problem.

SMTP verwendet normalerweise Port 25, aber es kann vorkommen, dass dieser von Ihrem ISP blockiert ist, versuchen Sie, auf Port 587 zu wechseln (oder Port 465, wenn Sie sich mittels SSL verbinden).

Welcher Server bei Freenet? ›

SMTP-Servermx.freenet.de
IMAP-Servermx.freenet.de
Benutzer/Kontonamename@domain (z.B. max.mustermann@freenet.de)
Ordner Posteinganginbox (je nach Programm auch "inbox.")
Ordner Gesendete Objektesent (je nach Programm auch "inbox.sent")
4 more rows

Was ist der POP3 Zugang bei Freenet? ›

Bei Fragen zum Thema freenet Mobilfunk, Internet, oder TV nutzen Sie bitte folgende Kontaktmöglichkeiten.
...
Ihr NameIhr Name (Dieser Name wird den Empfängern Ihrer Nachrichten angezeigt)
KontotypPOP3
Posteingangsservermx.freenet.de
Postausgangsservermx.freenet.de
BenutzernameIhre freenet Mail E-Mail-Adresse
2 more rows

Wie aktiviere ich SMTP Authentifizierung? ›

Klicken Sie im Dateimenü auf „Kontoeinstellungen“. Wählen Sie Ihr Konto aus und klicken Sie auf „Ändern“. Klicken Sie im sich öffnenden Fenster auf „Weitere Einstellungen“. Gehen Sie in die Registerkarte „Postausgangsserver“ und aktivieren Sie die Option „Postausgangsserver (SMTP) erfordert Authentifizierung“.

Wie bekomme ich den SMTP Server heraus? ›

Outlook für PC
  1. Klicken Sie in Outlook auf Datei. ...
  2. Doppelklicken Sie auf der Registerkarte E-Mail auf das Konto, das Sie mit der HubSpot-Software verbinden möchten.
  3. Unter Serverinformationen finden Sie die Namen des Posteingangsservers (IMAP) und des Postausgangsservers (SMTP).

Wie kontrolliere ich die SMTP Server Einstellungen? ›

Wähle in der App „Mail“ auf dem Mac „Mail“ > „Einstellungen“ und klicke auf „Accounts“. Wähle dann einen Account aus. Klicke auf „Servereinstellungen“, auf das Einblendmenü „Account für ausgehende E-Mails“ und wähle dann „SMTP-Serverliste bearbeiten“. Prüfe die Informationen für den Server.

Warum kann ich mich bei Freenet nicht mehr einloggen? ›

Der Login oder das Passwort wurden drei Mal falsch eingegeben. Zu Ihrer Sicherheit wird der Account für die Dauer von 10 Minuten gesperrt. Wenn in dieser Zeit weitere Login Versuche unternommen werden, verlängert sich die Sperre erneut auf 10 Minuten.

Wie verbinden ich Outlook mit Freenet? ›

Klicken Sie zunächst auf "Datei" und wählen Sie Über dem Menüpunkt "Kontoinformationen" die Schaltfläche "Konto hinzufügen". Tragen Sie hier Ihre freenet E-Mail-Adresse ein und setzen Sie den Haken bei "Ich möchte mein Konto manuell einrichten". Klicken Sie anschließend auf "Verbinden". Klicken Sie auf "IMAP".

Wie seriös ist Freenet? ›

Bewertung von Freenet - Anbieter im Vergleich auf wieistmeineip.de. Freenet bietet keine Internettarife mehr an, Bestandskunden wurden von 1&1 übernommen. Die Höchstwertung beträgt 5 Sterne, eine durchschnittliche Bewertung 3 Sterne, eine schlechte Bewertung 1 Stern.

Was muss ich bei IMAP Server eingeben? ›

Wenn Sie Benutzername und Kennwort für die Authentifizierung ausgewählt haben, geben Sie Ihren Benutzernamen für den Postausgangsserver ein. Wenn Sie Benutzername und Kennwort für die Authentifizierung ausgewählt haben, geben Sie Ihr Kennwort für den Postausgangsserver ein.

Wie kann ich POP3 und IMAP aktivieren? ›

Schritt 1: POP und IMAP aktivieren
  1. POP-Zugriff : Klicken Sie auf das Kästchen POP-Zugriff für alle Nutzer aktivieren .
  2. IMAP-Zugriff: Klicken Sie auf das Kästchen IMAP-Zugriff für alle Nutzer aktivieren wählen Sie eine Option aus: Alle E-Mail-Clients zulassen.

Was sind IMAP Zugangsdaten? ›

Dieser Benutzername entspricht dem Namen Ihres Postfaches (z.B. musterdomainde-0001) oder Sie verwenden Ihre E-Mail-Adresse als Benutzernamen. Als IMAP-Passwort verwenden Sie das Kennwort für Ihr E-Mail-Postfach.

Wie kann ich den POP3 SMTP Dienst aktivieren? ›

POP3/IMAP einschalten
  1. Klicken Sie im Reiter E-Mail auf Einstellungen.
  2. Wählen Sie POP3/IMAP Abruf aus.
  3. Setzen Sie unter WEB.DE Mail über POP3 & IMAP das Häkchen neben POP3 und IMAP Zugriff erlauben.
  4. Klicken Sie auf Speichern. Hier haben wir eigentlich eine Videoanleitung vorbereitet.

Was ist SMTP POP3 und IMAP? ›

Alle drei sind Protokolle, mit denen E-Mail-Versand ermöglicht wird. Kurz gesagt: Per SMTP (Simple Mail Transfer Protocol) versendest du E-Mails – per IMAP (Internet Message Access Protocol) und POP3 (Post Office Protocol Version 3) rufst du sie vom Server ab.

Videos

1. SPF, DKIM und Greylisting: Der neue E-Mail Spamschutz? [Kielux 2012]
(Kielux)
2. Linux Mail Server Configuration Step by Step
(mailserverguru)
3. SPIKE Email Review: Features, Pricing & Task/Notes (2020)
(Keep Productive )
4. So blockierst du auf deinem iPhone, iPad oder iPod touch einen Absender in Mail – Apple Support
(Apple Deutschland)
5. How to Add Your Business Email to Gmail for Free - Tutorial 2021
(Tips 2 Fix)
6. All You Need to Know About Hey.com
(Keep Productive )
Top Articles
Latest Posts
Article information

Author: Foster Heidenreich CPA

Last Updated: 02/19/2023

Views: 5820

Rating: 4.6 / 5 (56 voted)

Reviews: 95% of readers found this page helpful

Author information

Name: Foster Heidenreich CPA

Birthday: 1995-01-14

Address: 55021 Usha Garden, North Larisa, DE 19209

Phone: +6812240846623

Job: Corporate Healthcare Strategist

Hobby: Singing, Listening to music, Rafting, LARPing, Gardening, Quilting, Rappelling

Introduction: My name is Foster Heidenreich CPA, I am a delightful, quaint, glorious, quaint, faithful, enchanting, fine person who loves writing and wants to share my knowledge and understanding with you.